| request information: |
|
| Catalog Code: | H00007429-M02 |
| Product Name: | VIL1 Antibody |
| Product Description: | Mouse Monoclonal anti-VIL1 (3G6) |
| Clone: | 3G6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7429 |
| Gene Symbol: | VIL1 |
| Omim ID: | 193040, |
| Immunogen: | VIL1 (NP_009058, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. |
| Epitope: | MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGA* |
| Specificity: | VIL1 - villin 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Background: | This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-D2S1471 antibody, anti-VIL antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |