| request information: |
|
| Catalog Code: | H00007429-A01 |
| Product Name: | VIL1 Antibody |
| Product Description: | Mouse Polyclonal anti-VIL1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7429 |
| Gene Symbol: | VIL1 |
| Omim ID: | 193040 |
| Immunogen: | VIL1 (NP_009058, 1 a.a. ~ 78 a.a) partial recombinant protein with GST tag. |
| Epitope: | MTKLSAQVKGSLNITTPGLQIWRIEAMQMVPVPSSTFGSFFDGDCYIILAIHKTASSLSYDIHYWIGQDSSLDEQGA* |
| Specificity: | VIL1 - villin 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of a family of calcium-regulated actin-binding proteins. This protein represents a dominant part of the brush border cytoskeleton which functions in the capping, severing, and bundling of actin filaments. Two mRNAs of 2.7 kb and 3.5 kb have been observed; they result from utilization of alternate poly-adenylation signals present in the terminal exon. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-D2S1471 antibody, anti-VIL antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |