| CatalogCode: | H00007428-M01 |
| ProductName: | VHL Antibody |
| Product Description: | Mouse Monoclonal anti-VHL (1G12) |
| Clone: | 1G12 |
| Clonality: | Monoclonal |
| Immunogen: | VHL (NP_000542, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag. |
| Epitope: | MPRRAENWDEAEVGAEEAGVEEYGPEEDGGEESGAEESGPEESGPEELGAEEEMEAGRPRPVLRSVNSREPSQVIFCNRSPRVVLPVWLNFDGEPQPYPTLPPGTGRRIH* ... |
| Specificity: | VHL - von Hippel-Lindau tumor suppressor |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Von Hippel-Lindau syndrome (VHL) is a dominantly inherited familial cancer syndrome predisposing to a variety of malignant and benign tumors. A germline mutation of this gene is the basis of familial inheritance of VHL syndrome. The protein encoded by this gene is a component of the protein complex that includes elongin B, elongin C, and cullin-2, and possesses ubiquitin ligase E3 activity. This protein is involved in the ubiquitination and degradation of hypoxia-inducible-factor (HIF), which is a transcription factor that plays a central role in the regulation of gene expression by oxygen. RNA polymerase II subunit POLR2G/RPB7 is also reported to be a target of this protein. Alternatively spliced transcript variants encoding distinct isoforms have been observed. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-VHL antibody, anti-von Hippel-Lindau tumor suppressor antibody, anti-HRCA1 antibody, anti-RCA1 antibody, anti-VHL1antibody, anti-elongin binding protein antibody, anti-von Hippel-Lindau syndrome antibody |
| ProteinTarget: | VHL - von Hippel-Lindau tumor suppressor |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 7428 |
| Gene_Symbol: | VHL |
| Omim_ID: | 171300, 193300, 263400, 608537, |
order or
more information: | company product webpage |
| request information: |
|