| request information: |
|
| Catalog Code: | H00007424-A01 |
| Product Name: | VEGFC Antibody |
| Product Description: | Mouse Polyclonal anti-VEGFC |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7424 |
| Gene Symbol: | VEGFC |
| Omim ID: | 601528 |
| Immunogen: | VEGFC (NP_005420, 112 a.a. ~ 228 a.a) partial recombinant protein with GST tag. |
| Epitope: | AHYNTEILKSIDNEWRKTQCMPREVCIDVGKEFGVATNTFFKPPCVSVYRCGGCCNSEGLQCMNTSTSYLSKTLFEITV
PLSQGPKPVTISFANHTSCRCMSKLDVYRQVHSIIRR* |
| Specificity: | VEGFC - vascular endothelial growth factor C |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the platelet-derived growth factor/vascular endothelial growth factor (PDGF/VEGF) family, is active in angiogenesis and endothelial cell growth, and can also affect the permeability of blood vessels. This secreted protein undergoes a complex proteolytic maturation, generating multiple processed forms which bind and activate VEGFR-3 receptors. Only the fully processed form can bind and activate VEGFR-2 receptors. This protein is structurally and functionally similar to vascular endothelial growth factor D. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Flt4-L antibody, anti-VRP antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |