| Catalog Code: | H00007422-B01 |
| Product Type: | Primary Antibody |
| Product Name: | VEGF Antibody |
| List Price: | 295 |
| Clonality: | Polyclonal |
| Gene ID: | 7422 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-VEGF - vascular endothelial growth factor, MaxPab Antibody |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | This gene is a member of the PDGF/VEGF growth factor family and encodes a protein that is often found as a disulfide linked homodimer. This protein is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including me |
| Alternate Names: | anti-MGC70609 antibody, anti-VEGFA antibody, anti-VPF antibody |
| Immunogen: | VEGF (-, 1 a.a. ~ 147 a.a) full-length human protein. |
| Epitope: | MNFLLSWVHWSLALLLYLHHAKWSQAAPMAEGGGQNHHEVVKFMDVYQRSYCHPIETLVDIFQEYPDEIEYIFKPSCVPLMRCGGCCNDEGLECVPTEESNITMQIMRIKPHQGQHIGEMSFLQHNKCECRPKKDRARQEKCDKPRR ... |
| Preservative: | No Preservative |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |