| request information: |
|
| Catalog Code: | H00007421-M02 |
| Product Name: | VDR Antibody |
| Product Description: | Mouse Monoclonal anti-VDR (2F4) |
| Clone: | 2F4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7421 |
| Gene Symbol: | VDR |
| Omim ID: | 166710, 277440, 601769, |
| Immunogen: | VDR (AAH60832, 1 a.a. ~ 428 a.a) full length recombinant protein with GST tag. |
| Epitope: | MEAMAASTSLPDPGDFDRNVPRICGVCGDRATGFHFNAMTCEGCKGFFRRSMKRKALFTCPFNGDCRITKDNRRHCQAC
RLKRCVDIGMMKEFILTDEEVQRKREMILKRKEEEALKDSLRPKLSEEQQRIIAILLDAHHKTYDPTYSDFCQFRPPVR
VNDGGGSHPSRPNSRHTPSFSGDSSSSCSDHCITSSDMMDSSSFSNLDLSEEDSDDPSVTLELSQLSMLPHLADLVSYS
IQKVIGFAKMIPGFRDLT |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. It has also been used for immunohistochemistry on paraffin sections. |
| Background: | This gene encodes the nuclear hormone receptor for vitamin D3. This receptor also functions as a receptor for the secondary bile acid lithocholic acid. The receptor belongs to the family of trans-acting transcriptional regulatory factors and shows sequence similarity to the steroid and thyroid hormone receptors. Downstream targets of this nuclear hormone receptor are principally involved in mineral metabolism though the receptor regulates a variety of other metabolic pathways, such as those involved in the immune response and cancer. Mutations in this gene are associated with type II vitamin D-resistant rickets. A single nucleotide polymorphism in the initiation codon results in an alternate translation start site three codons downstream. Alternative splicing results in multiple transcript variants encoding the same protein. |
| Purity: | IgG purified |
| Host Name: | Mouse |
| Buffer: | 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin |
| Species Summary: | Hu , |
| Alternate Names: | anti-VDR antibody, anti-vitamin D (1 antibody, anti-25- dihydroxyvitamin D3) receptorantibody, anti-HGNC:12679 antibody, anti-NR1I1 antibody, anti-vitamin D (1 antibody, anti-25-dihydroxyvitamin D3) receptor antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |
|