| request information: |
|
| Catalog Code: | H00007411-M01 |
| Product Name: | VBP1 Antibody |
| Product Description: | Mouse Monoclonal anti-VBP1 (3D11) |
| Clone: | 3D11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7411 |
| Gene Symbol: | VBP1 |
| Omim ID: | 300133 |
| Immunogen: | VBP1 (AAH46094, 1 a.a. ~ 198 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAAVKDSCGKGEMATGNGRRLHLGIPEAVFVEDVDSFMKQPG NETADTVLKKLDEQYQKYKFMELNLAQKKRRLKGQIPEIKQT LEILKYMQKKKESTNSMETRFLLADNLYCKASVPPTDKVCLW LGANVMLEYDIDEAQALLEKNLSTATKNLDSLEEDLDFLRDQ FTTTEVNMARVYNWDVKRRNKDDSTKNKA* |
| Specificity: | VBP1 - von Hippel-Lindau binding protein 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Localization: | Cytoplasmic and Nuclear. Note=In complex with VHL can translocate to the nucleus. |
| Background: | The protein encoded by this gene interacts with the Von Hippel-Lindau protein to form an intracellular complex. Because it functions as a chaperone protein, it is suspected that it may play a role in the transport of the Von Hippel-Lindau protein from the perinuclear granules to the nucleus or cytoplasm. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-PFDN3 antibody, anti-HIBBJ 46 antibody, anti-HIBBJ46 antibody, anti-PFD 3 antibody, anti-PFD3 antibody, anti-PFDN 3 antibody, anti-Prefoldin 3 antibody, anti-Prefoldin subunit 3 antibody, anti-Prefoldin3 antibody, anti-VBP 1 antibody, anti-VBP1 antibody, anti-VHL binding protein 1 antibody, anti-Von Hippel Lindau binding protein 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |