ExactAntigen

VAV1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007409-M04
Product Type:Primary Antibody
Product Name:VAV1 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:7409
Host:Mouse
Clone:3A11
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-VAV1 - vav 1 oncogene (3A11)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development an
Alternate Names:anti-VAV antibody
Immunogen:VAV1 (AAH13361, 681 a.a. ~ 791 a.a) partial recombinant protein with GST tag.
Epitope:RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is
Gene Symbol:VAV1
see all human VAV1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about