| Catalog Code: | H00007409-M03 |
| Product Type: | Primary Antibody |
| Product Name: | VAV1 Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 7409 |
| Host: | Mouse |
| Clone: | 2C11 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-VAV1 (2C11) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development an |
| Alternate Names: | anti-VAV antibody |
| Immunogen: | VAV1 (AAH13361, 681 a.a. ~ 791 a.a) partial recombinant protein with GST tag. |
| Epitope: | RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | VAV1 |
| Omim ID: | 164875, |