| request information: |
|
| Catalog Code: | H00007409-M02 |
| Product Name: | VAV1 Antibody |
| Product Description: | Mouse Monoclonal anti-VAV1 (1A6) |
| Clone: | 1A6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7409 |
| Gene Symbol: | VAV1 |
| Omim ID: | 164875, |
| Immunogen: | VAV1 (AAH13361, 681 a.a. ~ 791 a.a) partial recombinant protein with GST tag. |
| Epitope: | RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNK
KGQQGWWRGEIYGRVGWFPANYVEEDYSEYC* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. This particular GEF has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-VAV antibody |
| Package Size: | 0.1 mg |
| Preservative: | No Preservative |
order or
more information: | company product webpage |