ExactAntigen

Mouse Monoclonal anti-VAV1 (9C1) | Novus Biologicals antibody product information
To request information:
enter your email address here
CatalogCode: H00007409-M01
ProductName: VAV1 Antibody
Product Description: Mouse Monoclonal anti-VAV1 (9C1)
Clone: 9C1
Clonality: Monoclonal
Immunogen: VAV1 (AAH13361, 681 a.a. ~ 791 a.a) partial recombinant protein with GST tag.
Epitope: RGLTELVEFYQQNSLKDCFKSLDTTLQFPFKEPEKRTISRPAVGSTKYFGTAKARYDFCARDRSELSLKEGDIIKILNKKGQQGWWRGEIYGRVGWFPANYVEEDYSEYC* ...
Specificity: VAV1 - vav 1 oncogene
CrossReactivity: Human. Other species not tested.
Packaging: 0.1 mg IgG purified Mouse ascites.
Uses: Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Background: The protein encoded by this proto-oncogene is a member of the Dbl family of guanine nucleotide exchange factors (GEF) for the Rho family of GTP binding proteins. The protein is important in hematopoiesis, playing a role in T-cell and B-cell development and activation. This particular GEF has been identified as the specific binding partner of Nef proteins from HIV-1. Coexpression and binding of these partners initiates profound morphological changes, cytoskeletal rearrangements and the JNK/SAPK signaling cascade, leading to increased levels of viral transcription and replication.
Storage: Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity: IgG purified
Isotype: IgG2b Kappa
Host_Name: Mouse
ListPrice: 295
AppSummary: ELISA, WB
SpeciesSummary: Hu
ALTnames: anti-VAV antibody
ProteinTarget: VAV1 - vav 1 oncogene
PackageSize: 0.1 mg
NotesMain: This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug).
Gene_Id: 7409
Gene_Symbol: VAV1
Omim_ID: 164875 H00007409-M04
more information: company product webpage
Also see:
see all human VAV1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about