| request information: |
|
| Catalog Code: | H00007376-M03 |
| Product Name: | nuclear receptor subfamily 1, group H, member 2 Antibody |
| Product Description: | Mouse Monoclonal anti-nuclear receptor subfamily 1, group H, member 2 (1B6) |
| Clone: | 1B6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7376 |
| Gene Symbol: | NR1H2 |
| Omim ID: | 600380, |
| Immunogen: | NR1H2 (AAH07790, 1 a.a. ~ 462 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKKGPAP
KMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQC
VLSEEQIRKKKIRKQQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQ
CNKRSFSDQPKVTPWPLG |
| Specificity: | nuclear receptor subfamily 1, group H, member 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate for western blot. It has also been used for ELISA. |
| Background: | The LX receptors (LXRs) were originally identified as orphan members of the nuclear receptor superfamily because their ligands were unknown. Like other receptors in the family, LXRs heterodimerize with retinoid X receptor (see MIM 180245) and bind to specific response elements (LXREs) characterized by direct repeats separated by 4 nucleotides. Two genes, alpha (LXRA, MIM 602423) and beta, are known to encode LXR proteins (Song et al., 1995 [PubMed 7625741]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-LXR-b antibody, anti-LXRB antibody, anti-NER antibody, anti-NER-I antibody, anti-RIP15 antibody, anti-UNR antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |