ExactAntigen

NR1H2 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007376-M01
Product Type:Primary Antibody
Product Name:NR1H2 Antibody
List Price:275
Clonality:Monoclonal
Gene ID:7376
Host:Mouse
Clone:2H2-H3
Isotype:IgG2a Kappa
Product Description:Mouse Monoclonal anti-NR1H2 (2H2-H3)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = NR1H2 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.The LX receptors (L
Alternate Names:anti-LXR-b antibody, anti-LXRB antibody, anti-NER antibody, anti-NER-I antibody, anti-RIP15 antibody, anti-UNR antibody
Immunogen:NR1H2 (AAH07790, 1 a.a. ~ 462 a.a) full length recombinant protein with GST tag.
Epitope:MSSPTTSSLDTPLPGNGPPQPGAPSSSPTVKEEGPEPWPGGPDPDVPGTDEASSACSTDWVIPDPEEEPERKRKKGPAPKMLGHELCRVCGDKASGFHYNVLSCEGCKGFFRRSVVRGGARRYACRGGGTCQMDAFMRRKCQQCRLRKCKEAGMREQCVLSEEQIRKKKIRKQQQQESQSQSQSPVGPQGSSSSASGPGASPGGSEAGSQGSGEGEGVQLTAAQELMIQQLVAAQLQCNKRSFSDQPKVTPWPLG ...
Specificity:NR1H2 - nuclear receptor subfamily 1, group H, member 2
Purity:IgG purified
Packaging:100 ug purified IgG
Package Size:0.1 ml
Uses:Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:NR1H2
Omim ID:600380
see all human NR1H2 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about