| request information: |
|
| Catalog Code: | H00007369-B01 |
| Product Name: | UMOD Antibody |
| Product Description: | Mouse Polyclonal anti-UMOD - uromodulin (uromucoid, Tamm-Horsfall glycoprotein), MaxPab Antibody |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 7369 |
| Gene Symbol: | UMOD |
| Immunogen: | UMOD (AAH35975, 1 a.a. ~ 611 a.a) full-length human protein. |
| Epitope: | MGQPSLTWMLMVVVASWFITTAATDTSEARWCSECHSNATCTEDEAVTTCTCQEGFTGDGLTCVDLDECAIPGAHNCSA
NSSCVNTPGSFSCVCPEGFRLSPGLGCTDVDECAEPGLSHCHALATCVNVVGSYLCVCPAGYRGDGWHCECSPGSCGPG
LDCVPEGDALVCADPCQAHRTLDEYWRSTEYGEGYACDTDLRGWYRPHPSSDEGIVSRKACAHWSGHCCLWDASVQVKA
CAGGYYVYNLTAPPECHL |
| Cross Reactivity: | Human. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody reactive against transfected lysate for Western Blot. Has also been used for immunofluoresence, and immunohistochemistry (paraffin sections), and ELISA. |
| Background: | This gene encodes uromodulin, the most abundant protein in normal urine. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. Uromodulin may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of uromodulin in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the autosomal dominant renal disorders medullary cystic kidney disease-2 (MCKD2) and familial juvenile hyperuricemic nephropathy (FJHN). These disorders are characterized by juvenile onset of hyperuricemia, gout, and progressive renal failure. While several transcript variants may exist for this gene, the full-length natures of only two have been described to date. These two represent the major variants of this gene and encode the same isoform. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ADMCKD2 antibody, anti-FJHN antibody, anti-HNFJ antibody, anti-MCKD2 antibody, anti-THGP antibody, anti-uromodulin antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |