| request information: |
|
| Catalog Code: | H00007350-M01 |
| Product Name: | UCP1 Antibody |
| Product Description: | Mouse Monoclonal anti-UCP1 (4E5) |
| Clone: | 4E5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7350 |
| Gene Symbol: | UCP1 |
| Omim ID: | 113730, 601665, |
| Immunogen: | UCP1 (NP_068605, 232 a.a. ~ 268 a.a) partial recombinant protein with GST tag. |
| Epitope: | PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Mitochondrial uncoupling proteins (UCP) are members of the family of mitochondrial anion carrier proteins (MACP). UCPs separate oxidative phosphorylation from ATP synthesis with energy dissipated as heat, also referred to as the mitochondrial proton leak. UCPs facilitate the transfer of anions from the inner to the outer mitochondrial membrane and the return transfer of protons from the outer to the inner mitochondrial membrane. They also reduce the mitochondrial membrane potential in mammalian cells. Tissue specificity occurs for the different UCPs and the exact methods of how UCPs transfer H+/OH- are not known. UCPs contain the three homologous protein domains of MACPs. This gene is expressed only in brown adipose tissue, a specialized tissue which functions to produce heat. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-UCP1 antibody, anti-uncoupling protein 1 (mitochondrial antibody, anti-proton carrier)antibody, anti-HGNC:12517 antibody, anti-SLC25A7 antibody, anti-UCPantibody, anti-mitochondrial brown fat uncoupling protein antibody, anti-uncoupling protein 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |