ExactAntigen

UCP1 Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007350-A01
Product Type:Primary Antibody
Product Name:UCP1 Antibody
List Price:205
Clonality:Polyclonal
Gene ID:7350
Host:Mouse
Product Description:Mouse Polyclonal anti-UCP1
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:NCBI Entrez Gene ID = 7350 PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.
Alternate Names:anti-UCP1 antibody, anti-uncoupling protein 1 (mitochondrial antibody, anti-proton carrier)antibody, anti-HGNC:12517 antibody, anti-SLC25A7 antibody, anti-UCPantibody, anti-mitochondrial brown fat uncoupling protein antibody, anti-uncoupling protein 1 ant
Immunogen:UCP1 (NP_068605, 232 a.a. ~ 268 a.a) partial recombinant protein with GST tag.
Epitope:PVDVVKTRFINSPPGQYKSVPNCAMKVFTNEGPTAF*
Specificity:UCP1 - uncoupling protein 1 (mitochondrial, proton carrier)
Purity:Whole antisera
Packaging:50 ul of mouse antisera with 50% glycerol. No preservative.
Package Size:50 ul
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnova's recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug).
Gene Symbol:UCP1
Omim ID:113730, 601665
see all human UCP1 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about