| Catalog Code: | H00007343-M02 |
| Product Type: | Primary Antibody |
| Product Name: | UBTF Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 7343 |
| Host: | Mouse |
| Clone: | 6C6 |
| Isotype: | IgG1 Kappa |
| Product Description: | Mouse Monoclonal anti-UBTF (6C6) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD, |
| Alternate Names: | anti-NOR-90 antibody, anti-UBF antibody |
| Immunogen: | UBTF (NP_055048, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag. |
| Epitope: | PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS* ... |
| Purity: | IgG purified |
| Buffer: | In 1x PBS, pH 7.2 |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Package Size: | 0.1 mg |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | ELISA, WB |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is |
| Gene Symbol: | UBTF |
| Omim ID: | 600673, |