ExactAntigen

UBTF Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007343-M02
Product Type:Primary Antibody
Product Name:UBTF Antibody
List Price:275
Clonality:Monoclonal
Gene ID:7343
Host:Mouse
Clone:6C6
Isotype:IgG1 Kappa
Product Description:Mouse Monoclonal anti-UBTF (6C6)
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Background:Upstream binding factor (UBF) is a transcription factor required for expression of the 18S, 5.8S, and 28S ribosomal RNAs, along with SL1 (a complex of TBP (MIM 600075) and multiple TBP-associated factors or 'TAFs'). Two UBF polypeptides, of 94 and 97 kD,
Alternate Names:anti-NOR-90 antibody, anti-UBF antibody
Immunogen:UBTF (NP_055048, 551 a.a. ~ 651 a.a) partial recombinant protein with GST tag.
Epitope:PPAATNSSKKMKFQGEPKKPPMNGYQKFSQELLSNGELNHLPLKERMVEIGSRWQRISQSQKEHYKKLAEEQQKQYKVHLDLWVKSLSPQDRAAYKEYIS* ...
Purity:IgG purified
Buffer:In 1x PBS, pH 7.2
Packaging:0.1 mg IgG purified Mouse ascites.
Package Size:0.1 mg
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:ELISA, WB
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:UBTF
Omim ID:600673,
see all human UBTF antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about