| request information: |
|
| Catalog Code: | H00007342-M01 |
| Product Name: | UBP1 Antibody |
| Product Description: | Mouse Monoclonal anti-UBP1 (1C5) |
| Clone: | 1C5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7342 |
| Gene Symbol: | UBP1 |
| Omim ID: | 609784, |
| Immunogen: | UBP1 (AAH47235, 1 a.a. ~ 541 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAWVLKMDEVIESGLVHDFDASLSGIGQELGAGAYSMSDVLALPIFKQEDSSLPLDGETEHPPFQYVMCAATSPAVKLH
DETLTYLNQGQSYEIRMLDNRKMGDMPEINGKLVKSIIRVVFHDRRLQYTEHQQLEGWKWNRPGDRLLDLDIPMSVGII
DTRTNPSQLNAVEFLWDPAKRTSAFIQVHCISTEFTPRKHGGEKGVPFRIQVDAFKQNENGEYTDHLHSASCQIKVFKP
KGADRKQKTDREKMEKRT |
| Specificity: | UBP1 - upstream binding protein 1 (LBP-1a) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-DKFZp686L1745 antibody, anti-LBP-1B antibody, anti-LBP-1a antibody, anti-LBP1A antibody, anti-LBP1B antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |