| Catalog Code: | H00007337-M01 |
| Product Type: | Primary Antibody |
| Product Name: | UBE3A Antibody |
| List Price: | 275 |
| Clonality: | Monoclonal |
| Gene ID: | 7337 |
| Host: | Mouse |
| Clone: | 2F6 |
| Isotype: | IgG2a Kappa |
| Product Description: | Mouse Monoclonal anti-UBE3A (2F6) |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Background: | NCBI Entrez Gene ID = UBE3A PLEASE NOTE - This product originates in Taiwan. If in stock in Taiwan, delivery is 10-14 days. If not in stock, lead times can be extended. We will inform you of any extended delays within 48 hours.This gene encodes a |
| Alternate Names: | anti-ANCR antibody, anti-AS antibody, anti-E6-AP antibody, anti-EPVE6AP antibody, anti-HPVE6A antibody |
| Immunogen: | UBE3A (AAH09271, 51 a.a. ~ 151 a.a) partial recombinant protein with GST tag. |
| Epitope: | ETFQQLITYKVISNEFNSRNLVNDDDAIVAASKCLKMVYYANVVGGEVDTNHNEEDDEEPIPESSELTLQELLGEERRNKKGPRVDPLETELGVKTLDCR* ... |
| Specificity: | UBE3A - ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome) |
| Purity: | IgG purified |
| Packaging: | 100 ug purified IgG |
| Package Size: | 0.1 ml |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates. It has also been used in immunohistochemis |
| Application Summary: | ELISA, WB, IHC-P |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova The immunizing protein is also available for this product. Unit cost for the protein is $ 235 (2 ug), $ 285 (10 ug), and $ 425 (25 ug). |
| Gene Symbol: | UBE3A |
| Omim ID: | 105830, 601623, |