| request information: |
|
| Catalog Code: | H00007336-B01 |
| Product Name: | UBE2V2 Antibody |
| Product Description: | Mouse Polyclonal anti-UBE2V2 |
| Clonality: | Polyclonal |
| ListPrice: | 295 |
| Gene ID: | 7336 |
| Gene Symbol: | UBE2V2 |
| Omim ID: | 603001, |
| Immunogen: | UBE2V2 (AAH07051, 1 a.a. ~ 146 a.a) full-length human protein. |
| Epitope: | MAVPTGVKVPRNFRLLEELEEGQKGVGDGTVSWGLEDDEDMTLTRWTGMIIGPPRTNYENRVYSLKVECGPKYPEAPPS
VRFVTKINMNGINNSSGMVDARSIPVLAKWQNSYSIKVVLQELRRLMMSKENMKLPQPPEGQTYNN* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | Ubiquitin-conjugating enzyme E2 variant proteins constitute a distinct subfamily within the E2 protein family. They have sequence similarity to other ubiquitin-conjugating enzymes but lack the conserved cysteine residue that is critical for the catalytic activity of E2s. The protein encoded by this gene also shares homology with ubiquitin-conjugating enzyme E2 variant 1 and yeast MMS2 gene product. It may be involved in the differentiation of monocytes and enterocytes. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | Western Blot, ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-DDVIT1 antibody, anti-DDVit-1 antibody, anti-EDAF-1 antibody, anti-EDPF-1 antibody, anti-EDPF1 antibody, anti-MMS2 antibody, anti-UEV-2 antibody, anti-UEV2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No Preservative |
order or
more information: | company product webpage |