| request information: |
|
| Catalog Code: | H00007334-M01 |
| Product Name: | UBE2N Antibody |
| Product Description: | Mouse Monoclonal anti-UBE2N (4C11-G11) |
| Clone: | 4C11-G11 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7334 |
| Gene Symbol: | UBE2N |
| Omim ID: | 603679 |
| Immunogen: | UBE2N (AAH03365, 1 a.a. ~ 153 a.a) full length recombinant protein with GST tag. |
| Epitope: | MAGLPRRIIKETQRLLAEPVPGIKAEPDESNARYFHVVIAGP QDSPFEGGTFKLELFLPEEYPMAAPKVRFMTKIYHPNVDKLG RICLDILKDKWSPALQIRTVLLSIQALLSAPNPDDPLANDVA EQWKTNEAQAIETARAWTRLYAMNNI* |
| Specificity: | UBE2N - ubiquitin-conjugating enzyme E2N (UBC13 homolog, yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Localization: | Nuclear |
| Background: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. Studies in mouse suggest that this protein plays a role in DNA postreplication repair. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-bendless like ubiquitin conjugating enzyme antibody, anti-BLU antibody, anti-Human epidermoid carcinoma mRNA for ubiquitin-conjugating enzyme E2 similar to Drosophila bendless gene product complete cds antibody, anti-MGC131857 antibody, anti-MGC8489 antibody, anti-UBC 13 antibody, anti-UBC13 antibody, anti-UbCH ben antibody, anti-Ube 2N antibody, anti-ubiquitin carrier protein N antibody, anti-Ubiquitin conjugating enzyme E2N antibody, anti-ubiquitin protein ligase N antibody, anti-Ubiquitin-conjugating enzyme E2 N antibody, anti-ubiquitin-conjugating enzyme E2N (homologous to yeast UBC13) antibody, anti-ubiquitin-conjugating enzyme E2N (UBC13 homolog yeast) antibody, anti-Yeast UBC13 homolog antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |