| CatalogCode: | H00007328-M01 |
| ProductName: | UBE2H Antibody |
| Product Description: | Mouse Monoclonal anti-UBE2H (3C4-1A2) |
| Clone: | 3C4-1A2 |
| Clonality: | Monoclonal |
| Immunogen: | UBE2H (AAH06277, 1 a.a. ~ 184 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSSPSPGKRRMDTDVVKLIESKHEVTILGGLNEFVVKFYGPQGTPYEGGVWKVRVDLPDKYPFKSPSIGFMNKIFHPNIDEASGTVCLDVINQTWTALYDLTNIFESFLPQLLAYPNPIDPLNGDAAAMYLHRPEEYKQKIKEYIQKYATEEALKEQEEGTGDSSSESSMSDFSEDEAQDMEL* ... |
| Specificity: | UBE2H - ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. The antibody is also shown to be specific in Western blot against cell lysates and has been used in immunofluorescence. |
| Background: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein sequence is 100% identical to the mouse homolog and 98% identical to the frog and zebrafish homologs. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a kappa |
| Host_Name: | Mouse |
| ListPrice: | 295 |
| AppSummary: | ELISA, WB, IF |
| SpeciesSummary: | Hu |
| ALTnames: | anti-E2-20K antibody, anti-UBC8 antibody, anti-UBCH antibody, anti-UBCH2 antibody |
| ProteinTarget: | UBE2H - ubiquitin-conjugating enzyme E2H (UBC8 homolog, yeast) |
| PackageSize: | 0.1 mg |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 7328 |
| Gene_Symbol: | UBE2H |
| Omim_ID: | 601082 NB300-812 |
order or more information: | company product webpage |
| request information: | |