| request information: |
|
| Catalog Code: | H00007327-A01 |
| Product Name: | UBE2G2 Antibody |
| Product Description: | Mouse Polyclonal anti-UBE2G2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7327 |
| Gene Symbol: | UBE2G2 |
| Omim ID: | 603124 |
| Immunogen: | UBE2G2 (1 a.a. ~ 88 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAGTALKRLMAEYKQLTLNPPEGIVAGPMNEENFFEWEALIMGPEDTCFEFGVFPAILSFPLDYPLSPPKMRFTCEMFH
PNIYPDGR* |
| Specificity: | UBE2G2 - ubiquitin-conjugating enzyme E2G 2 (UBC7 homolog, yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. The encoded protein shares 100% sequence identity with the mouse counterpart. This gene is ubiquitously expressed, with high expression seen in adult muscle. Two alternatively spliced transcript variants encoding distinct isoforms have been found for this gene. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-UBC7 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |