| request information: |
|
| Catalog Code: | H00007326-M01 |
| Product Name: | UBE2G1 Antibody |
| Product Description: | Mouse Monoclonal anti-UBE2G1 (1C12-1B2) |
| Clone: | 1C12-1B2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7326 |
| Gene Symbol: | UBE2G1 |
| Omim ID: | 601569 |
| Immunogen: | UBE2G1 (AAH02775, 1 a.a. ~ 171 a.a) full length recombinant protein with GST tag. |
| Epitope: | MTELQSALLLRRQLAELNKNPVEGFSAGLIDDNDLYRWEVLIIGPPDTLYEGGVFKAHLTFPKDYPLRPPKMKFITEIW
HPNVDKNGDVCISILHEPGEDKYGYEKPEERWLPIHTVETIMISVISMLADPNGDSPANVDAAKEWREDRNGEFKRKVA
RCVRKSQETAFE* |
| Specificity: | UBE2G1 - ubiquitin-conjugating enzyme E2G 1 (UBC7 homolog, C. elegans) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family and catalyzes the covalent attachment of ubiquitin to other proteins. The protein may be involved in degradation of muscle-specific proteins. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu , |
| Alternate Names: | anti-E217K antibody, anti-UBC7 antibody, anti-UBE2G antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |