| request information: |
|
| Catalog Code: | H00007322-A01 |
| Product Name: | UBE2D2 Antibody |
| Product Description: | Mouse Polyclonal anti-UBE2D2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7322 |
| Gene Symbol: | UBE2D2 |
| Omim ID: | 602962 |
| Immunogen: | UBE2D2 (NP_003330, 1 a.a. ~ 95 a.a) partial recombinant protein with GST tag. |
| Epitope: | MALKRIHKELNDLARDPPAQCSAGPVGDDMFHWQATIMGPNDSPYQGGVFFLTIHFPTDYPFKPPKVAFTTRIYHPNIN
SNGSICLDILRSQWS* |
| Specificity: | UBE2D2 - ubiquitin-conjugating enzyme E2D 2 (UBC4/5 homolog, yeast) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme functions in the ubiquitination of the tumor-suppressor protein p53, which is induced by an E3 ubiquitin-protein ligase. Two alternatively spliced transcript variants have been found for this gene and they encode distinct isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-E2(17)KB2 antibody, anti-PUBC1 antibody, anti-UBC4 antibody, anti-UBC4/5 antibody, anti-UBCH5B antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |