| request information: |
|
| Catalog Code: | H00007320-A01 |
| Product Name: | UBE2B Antibody |
| Product Description: | Mouse Polyclonal anti-UBE2B |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7320 |
| Gene Symbol: | UBE2B |
| Omim ID: | 179095 |
| Immunogen: | UBE2B (NP_003328, 63 a.a. ~ 153 a.a) partial recombinant protein with GST tag. |
| Epitope: | YPNKPPTVRFLSKMFHPNVYADGSICLDILQNRWSPTYDVSSILTSIQSLLDEPNPNSPANSQAAQLYQENKREYEKRV
SAIVEQSWNDS |
| Specificity: | UBE2B - ubiquitin-conjugating enzyme E2B (RAD6 homolog) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The modification of proteins with ubiquitin is an important cellular mechanism for targeting abnormal or short-lived proteins for degradation. Ubiquitination involves at least three classes of enzymes: ubiquitin-activating enzymes, or E1s, ubiquitin-conjugating enzymes, or E2s, and ubiquitin-protein ligases, or E3s. This gene encodes a member of the E2 ubiquitin-conjugating enzyme family. This enzyme is required for post-replicative DNA damage repair. Its protein sequence is 100% identical to the mouse, rat, and rabbit homologs, which indicates that this enzyme is highly conserved in eukaryotic evolution. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-E2-17kDa antibody, anti-HHR6B antibody, anti-HR6B antibody, anti-RAD6B antibody, anti-UBC2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |