ExactAntigen

TYRO3 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00007301-A01
Product Name:TYRO3 Antibody
Product Description:Mouse Polyclonal anti-TYRO3
Clonality:Polyclonal
ListPrice:225
Gene ID:7301
Gene Symbol:TYRO3
Omim ID:600341
Immunogen:TYRO3 (AAH49368, 50 a.a. ~ 150 a.a) partial recombinant protein with GST tag.
Epitope:VKLTVSQGQPVKLNCSVEGMEEPDIQWVKDGAVVQNLDQLYIPVSEQHWIGFLSLKSVERSDAGRYWCQVEDGGETEIS
QPVWLTVEGVPFFTVEPKDLAV
Specificity:TYRO3 - TYRO3 protein tyrosine kinase
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-Tyro3 antibody, anti-Tyrosine Kinase Tyro3 precursor antibody, anti-Tyrosine-protein kinase RSE antibody, anti-Tyrosine-protein kinase SKY antibody, anti-Tyrosine-protein kinase DTK antibody, anti-Tyrosine-protein kinase byk antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human TYRO3 antibodies


2008©ExactAntigen home | browse | about