| request information: |
|
| Catalog Code: | H00007293-A01 |
| Product Name: | TNFRSF4 Antibody |
| Product Description: | Mouse Polyclonal anti-TNFRSF4 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7293 |
| Gene Symbol: | TNFRSF4 |
| Omim ID: | 600315 |
| Immunogen: | TNFRSF4 (NP_003318, 31 a.a. ~ 131 a.a) partial recombinant protein with GST tag. |
| Epitope: | CVGDTYPSNDRCCHECRPGNGMVSRCSRSQNTVCRPCGPGFYNDVVSSKPCKPCTWCNLRSGSERKQLCTATQDTVCRC
RAGTQPLDSYKPGVDCAPCPP* |
| Specificity: | TNFRSF4 - tumor necrosis factor receptor superfamily, member 4 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the TNF-receptor superfamily. This receptor has been shown to activate NF-kappaB through its interaction with adaptor proteins TRAF2 and TRAF5. Knockout studies in mice suggested that this receptor promotes the expression of apoptosis inhibitors BCL2 and BCL2lL1/BCL2-XL, and thus suppresses apoptosis. The knockout studies also suggested the roles of this receptor in CD4+ T cell response, as well as in T cell-dependent B cell proliferation and differentiation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-ACT35 antibody, anti-CD134 antibody, anti-OX40 antibody, anti-TXGP1L antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |