ExactAntigen

TUBB2A Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
Catalog Code:H00007280-B01
Product Type:Primary Antibody
Product Name:TUBB2A Antibody
List Price:275
Clonality:Polyclonal
Gene ID:7280
Host:Mouse
Product Description:Mouse Polyclonal anti-TUBB2A
Cross Reactivity:Human. Other species not tested.
Species Summary:Hu
Alternate Names:anti-TUBB antibody, anti-TUBB2 antibody, anti-dJ40E16.7 antibody
Immunogen:TUBB2A (AAH01194, 1 a.a. ~ 446 a.a) full-length human protein.
Epitope:MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAV ...
Packaging:50 ul of mouse antisera with 50% glycerol.
Package Size:0.05 ml
Uses:Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control.
Application Summary:WB, ELISA
Notes Main:This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is
Gene Symbol:TUBB2A
see all human TUBB2A antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about