| Catalog Code: | H00007280-B01 |
| Product Type: | Primary Antibody |
| Product Name: | TUBB2A Antibody |
| List Price: | 275 |
| Clonality: | Polyclonal |
| Gene ID: | 7280 |
| Host: | Mouse |
| Product Description: | Mouse Polyclonal anti-TUBB2A |
| Cross Reactivity: | Human. Other species not tested. |
| Species Summary: | Hu |
| Alternate Names: | anti-TUBB antibody, anti-TUBB2 antibody, anti-dJ40E16.7 antibody |
| Immunogen: | TUBB2A (AAH01194, 1 a.a. ~ 446 a.a) full-length human protein. |
| Epitope: | MREIVHIQAGQCGNQIGAKFWEVISDEHGIDPTGSYHGDSDLQLERINVYYNEAAGNKYVPRAILVDLEPGTMDSVRSGPFGQIFRPDNFVFGQSGAGNNWAKGHYTEGAELVDSVLDVVRKESESCDCLQGFQLTHSLGGGTGSGMGTLLISKIREEYPDRIMNTFSVMPSPKVSDTVVEPYNATLSVHQLVENTDETYSIDNEALYDICFRTLKLTTPTYGDLNHLVSATMSGVTTCLRFPGQLNADLRKLAV ... |
| Packaging: | 50 ul of mouse antisera with 50% glycerol. |
| Package Size: | 0.05 ml |
| Uses: | Antibody Reactive Against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Application Summary: | WB, ELISA |
| Notes Main: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours.The immunizing protein is |
| Gene Symbol: | TUBB2A |