ExactAntigen

TUBA1 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00007277-M02
Product Name:TUBA1 Antibody
Product Description:Mouse Monoclonal anti-TUBA1 (1G12)
Clone:1G12
Clonality:Monoclonal
ListPrice:295
Gene ID:7277
Gene Symbol:TUBA1
Omim ID:191110,
Immunogen:TUBA1 (AAH09238, 1 a.a. ~ 449 a.a) full length recombinant protein with GST tag.
Epitope:MRECISVHVGQAGVQMGNACWELYCLEHGIQPDGQMPSDKTIGGGDDSFTTFFCETGAGKHVPRAVFVDLEPTVIDEIR
NGPYRQLFHPEQLITGKEDAANNYARGHYTIGKEIIDPVLDRIRKLSDQCTGLQGFLVFHSFGGGTGSGFTSLLMERLS
VDYGKKSKLEFSIYPAPQVSTAVVEPYNSILTTHTTLEHSDCAFMVDNEAIYDICRRNLDIERPTYTNLNRLISQIVSS
ITASLRFDGALNVDLTEF
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against transfected lysate and recombinant protein for western blot. It has also been used for ELISA.
Background:Microtubules of the eukaryotic cytoskeleton perform essential and diverse functions and are composed of a heterodimer of alpha and beta tubulin. The genes encoding these microtubule constituents are part of the tubulin superfamily, which is composed of six distinct families. Genes from the alpha, beta and gamma tubulin families are found in all eukaryotes. The alpha and beta tubulins represent the major components of microtubules, while gamma tubulin plays a critical role in the nucleation of microtubule assembly. There are multiple alpha and beta tubulin genes and they are highly conserved among and between species. This gene encodes an alpha tubulin that is a highly conserved homolog of a rat testis-specific alpha tubulin.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Buffer:In 1x PBS, pH 7.2
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-FLJ30169 antibody, anti-H2-ALPHA antibody
Package Size:0.1 mg
Preservative:No Preservative
order or
more information
:
company product webpage
Also see:
all human TUBA4A antibodies


2008©ExactAntigen home | browse | about