ExactAntigen

TTN Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00007273-M06
Product Name:TTN Antibody
Product Description:Mouse Monoclonal anti-TTN (7D3)
Clone:7D3
Clonality:Monoclonal
ListPrice:295
Gene ID:7273
Gene Symbol:TTN
Omim ID:188840, 600334, 604145, 608807,
Immunogen:TTN (AAH58824, 1 a.a. ~ 111 a.a) partial recombinant protein with GST tag.
Epitope:MTTQAPTFTQPLQSVVVLEGSTATFEAHISGFPVPEVSWFRDGQVISTSTLPGVQISFSDGRAKLTIPAVTKANSGRYS
LKATNGSGQATSTAELLVKAETAPPNFVQRL*
Specificity:TTN - titin
Cross Reactivity:Human. Other species not tested.
Packaging:0.1 mg IgG purified Mouse ascites.
Uses:Antibody reactive against recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA.
Background:This gene encodes a large abundant protein of striated muscle. The product of this gene is divided into two regions, a N-terminal I-band and a C-terminal A-band. The I-band, which is the elastic part of the molecule, contains two regions of tandem immunoglobulin domains on either side of a PEVK region that is rich in proline, glutamate, valine and lysine. The A-band, which is thought to act as a protein-ruler, contains a mixture of immunoglobulin and fibronectin repeats, and possesses kinase activity. A N-terminal Z-disc region and a C-terminal M-line region bind to the Z-line and M-line of the sarcomere respectively so that a single titin molecule spans half the length of a sarcomere. Titin also contains binding sites for muscle associated proteins so it serves as an adhesion template for the assembly of contractile machinery in muscle cells. It has also been identified as a structural protein for chromosomes. Considerable variability exists in the I-band, the M-line and the Z-disc regions of titin. Variability in the I-band region contributes to the differences in elasticity of different titin isoforms and, therefore, to the differences in elasticity of different muscle types. Of the many titin variants identified, five for which complete transcript information is available are described. Mutations in this gene are associated with familial hypertrophic cardiomyopathy 9 and autoantibodies to titin are produced in patients with the autoimmune disease scleroderma.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:IgG purified
Isotype:IgG2a Kappa
Host Name:Mouse
Application Summary:ELISA, Immunohistochemistry-Paraffin, Western Blot
Species Summary:Hu
Alternate Names:anti-CMD1G antibody, anti-CMH9 antibody, anti-CMPD4 antibody, anti-DKFZp451N061 antibody, anti-FLJ32040 antibody, anti-LGMD2J antibody, anti-TMD antibody
Package Size:0.1 mg
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human titin antibodies


2008©ExactAntigen home | browse | about