| request information: |
|
| Catalog Code: | H00007249-A01 |
| Product Name: | TSC2 Antibody |
| Product Description: | Mouse Polyclonal anti-TSC2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7249 |
| Gene Symbol: | TSC2 |
| Omim ID: | 191092, 191100, 606690, |
| Immunogen: | TSC2 (NP_000539, 540 a.a. ~ 659 a.a) partial recombinant protein with GST tag. |
| Epitope: | SPPPELEERDVAAYSASLEDVKTAVLGLLVILQTKLYTLPASHATRVYEMLVSHIQLHYKHSYTLPIASSIRLQAFDFL
FLLRADSLHRLGLPNKDGVVRFSPYCVCDYMEPERGSEKK* |
| Specificity: | TSC2 - tuberous sclerosis 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. <br>Abnovas recommended working dilutions for western analysis are as follows:<br>1:500 dilution for ascites<br>1:1000 for purified Ig<br>1:500-1:1000 for polysera |
| Background: | Mutations in this gene lead to tuberous sclerosis complex. Its gene product is believed to be a tumor suppressor and is able to stimulate specific GTPases. The protein associates with hamartin in a cytosolic complex, possibly acting as a chaperone for hamartin. Alternative splicing results in multiple transcript variants encoding different isoforms. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TSC2 antibody, anti-TSC-2 antibody, anti-Tuberous Sclerosis 2 antibody, anti-Tuberin antibody, anti-LAM antibody, anti-TSC 2 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |