| request information: |
|
| Catalog Code: | H00007205-M04 |
| Product Name: | TRIP6 Antibody |
| Product Description: | Mouse Monoclonal anti-TRIP6 (4B7) |
| Clone: | 4B7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7205 |
| Gene Symbol: | TRIP6 |
| Omim ID: | 602933, |
| Immunogen: | TRIP6 (NP_003293, 51 a.a. ~ 149 a.a) partial recombinant protein with GST tag. |
| Epitope: | SEQCYQAPGGPEDRGPAWVGSHGVLQHTQGLPADRGGLRPGSLDAEIDLLSSTLAELNGGRGHASRRPDRQAYEPPPPP
AYRTGSLKPNPASPLPASP* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunofluoresence and ELISA. |
| Background: | This gene is a member of the zyxin family and encodes a protein with three LIM zinc-binding domains. This protein localizes to focal adhesion sites and along actin stress fibers. Recruitment of this protein to the plasma membrane occurs in a lysophosphatidic acid (LPA)-dependent manner and it regulates LPA-induced cell migration. Alternatively spliced variants which encode different protein isoforms have been described; however, not all variants have been fully characterized. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG3 Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TRIP6 antibody, anti-TRIP-6 antibody, anti-Thyroid Receptor Interacting Protein 6 antibody, anti-OIP1 antibody, anti-OPA-Interacting Protein 1 antibody, anti-ZRP-1 antibody, anti-Zyxin Related Protein 1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |