ExactAntigen

Mouse Polyclonal anti-TRAF5 - TNF receptor-associated factor 5, MaxPab Antibody
For more information about this product,
enter your email address here
or visit directly company product webpage
.
CatalogCode:H00007188-B01
ProductName:TRAF5 Antibody
Product Description:Mouse Polyclonal anti-TRAF5 - TNF receptor-associated factor 5, MaxPab Antibody
Clonality:Polyclonal
Immunogen:TRAF5 (NP_001029082, 1 a.a. ~ 557 a.a) full-length human protein.
Epitope:MAYSEEHKGMPCGFIRQNSGNSISLDFEPSIEYQFVERLEERYKCAFCHSVLHNPHQTGCGHRFCQHCILSLRELNTVPICPVDKEVIKSQEVFKDNCCKREVLNLYVYCSNAPGCNAKVILGRYQDHLQQCLFQPVQCSNEKCREPVLRKDLKEHLSASCQFRKEKCLYCKKDVVVINLQNHEENLCPEYPVFCPNNCAKIILKTEVDEHLAVCPEAEQDCPFKHYGCAVTDKRRNLQQHEHSALREHMRLVLE ...
CrossReactivity:Human.
Packaging:0.05 ml of mouse antisera with 50% glycerol.
Uses:Antibody Reactive Against Immunizing Recombinant Protein or Transfected Lysate on ELISA and Western Blot.
Background:The scaffold protein encoded by this gene is a member of the tumor necrosis factor receptor-associated factor (TRAF) protein family and contains a meprin and TRAF homology (MATH) domain, a RING-type zinc finger, and two TRAF-type zinc fingers. TRAF proteins are associated with, and mediate signal transduction from members of the TNF receptor superfamily. This protein is one of the components of a multiple protein complex which binds to tumor necrosis factor (TNF) receptor cytoplasmic domains and mediates TNF-induced activation. Alternate transcriptional splice variants have been characterized.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Host_Name:Mouse
ListPrice:295
AppSummary:WB, ELISA
SpeciesSummary:Hu
ALTnames:anti-MGC:39780 antibody, anti-RNF84 antibody
ProteinTarget:TNF receptor-associated factor 5
PackageSize:0.05 ml
NotesMain:This antibody is available only in North America and is supplied by Abnova. Lead time may be 10-14 days. The immunizing protein may also available for this product. Unit cost for the protein is $250 (2 ug), $305 (10 ug), and $445 (25 ug). MaxPab is a registered trademark of Abnova.
Gene_Id:7188
Gene_Symbol:TRAF5
see all human TRAF5 antibodies
see anti mouse secondary antibodies


2008©ExactAntigen home | browse | about