| request information: |
|
| Catalog Code: | H00007187-A01 |
| Product Name: | TRAF3 Antibody |
| Product Description: | Mouse Polyclonal anti-TRAF3 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7187 |
| Gene Symbol: | TRAF3 |
| Omim ID: | 601896 |
| Immunogen: | TRAF3 (NP_663777, 298 a.a. ~ 411 a.a) partial recombinant protein with GST tag. |
| Epitope: | FEIEIERQKEMLRNNESKILHLQRVIDSQAEKLKELDKEIRPFRQNWEEADSMKSSVESLQNRVTELESVDKSAGQVAR
NTGLLESQLSRHDQMLSVHDIRLADMDLRFQVLE* |
| Specificity: | TRAF3 - TNF receptor-associated factor 3 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from, members of the TNF receptor (TNFR) superfamily. This protein participates in the signal transduction of CD40, a TNFR family member important for the activation of the immune response. This protein is found to be a critical component of the lymphotoxin-beta receptor (LTbetaR) signaling complex, which induces NF-kappaB activation and cell death initiated by LTbeta ligation. Epstein-Barr virus encoded latent infection membrane protein-1 (LMP1) can interact with this and several other members of the TRAF family, which may be essential for the oncogenic effects of LMP1. Three alternatively spliced transcript variants encoding two distinct isoforms have been reported. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CAP-1 antibody, anti-CD40bp antibody, anti-CRAF1 antibody, anti-LAP1 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |