ExactAntigen

TRAF2 Antibody | Novus Biologicals antibody product information
request information:
Catalog Code:H00007186-A01
Product Name:TRAF2 Antibody
Product Description:Mouse Polyclonal anti-TRAF2
Clonality:Polyclonal
ListPrice:225
Gene ID:7186
Gene Symbol:TRAF2
Omim ID:601895
Immunogen:TRAF2 (AAH43492, 1 a.a. ~ 502 a.a) full length recombinant protein with GST tag.
Epitope:MAAASVTPPGSLELLQPGFSKTLLGTKLEAKYLCSACRNVLRRPFQAQCGHRYCSFCLASILSSGPQNCAACVHEGIYE
EGISILESSSAFPDNAARREVESLPAVCPSDGCTWKGTLKEYESCHEGRCPLMLTECPACKGLVRLGEKERHLEHECPE
RSLSCRHCRAPCCGADVKAHHEVCPKFPLTCDGCGKKKIPREKFQDHVKTCGKCRVPCRFHAIGCLETVEGEKQQEHEV
QWLREHLAMLLSSVLEAK
Specificity:TRAF2 - TNF receptor-associated factor 2
Cross Reactivity:Human. Other species not tested.
Packaging:0.05 ml of mouse antisera with 50% glycerol. No preservative.
Uses:Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA.
Background:The protein encoded by this gene is a member of the TNF receptor associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from members of the TNF receptor superfamily. This protein directly interacts with TNF receptors, and forms a heterodimeric complex with TRAF1. This protein is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF1 interacts with the inhibitor-of-apoptosis proteins (IAPs), and functions as a mediator of the anti-apoptotic signals from TNF receptors. The interaction of this protein with TRADD, a TNF receptor associated apoptotic signal transducer, ensures the recruitment of IAPs for the direct inhibition of caspase activation. BIRC2/c-IAP1, an apoptosis inhibitor possessing ubiquitin ligase activity, can unbiquitinate and induce the degradation of this protein, and thus potentiate TNF-induced apoptosis. Multiple alternatively spliced transcript variants have been found for this gene, but the biological validity of only one transcript has been determined.
Storage:Aliquot and store at -20C or -80C.  Avoid freeze-thaw cycles.
Purity:Whole antisera
Host Name:Mouse
Application Summary:ELISA, Western Blot
Species Summary:Hu
Alternate Names:anti-MGC:45012 antibody, anti-TRAP antibody, anti-TRAP3 antibody
Package Size:0.05 ml
Preservative:No preservative
order or
more information
:
company product webpage
Also see:
all human TRAF2 antibodies


2008©ExactAntigen home | browse | about