| request information: |
|
| Catalog Code: | H00007185-M01 |
| Product Name: | TRAF1 Antibody |
| Product Description: | Mouse Monoclonal anti-TRAF1 (2G6-G10) |
| Clone: | 2G6-G10 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7185 |
| Gene Symbol: | TRAF1 |
| Omim ID: | 601711 |
| Immunogen: | TRAF1 (AAH24145, 1 a.a. ~ 417 a.a) full length recombinant protein with GST tag. |
| Epitope: | MASSSGSSPRPAPDENEFPFGCPPTVCQDPKEPRALCCAGCLSENPRNGEDQICPKCRGEDLQSISPGSRLRTQEKAHP
EVAEAGIGCPFAGVGCSFKGSPQSVQEHEVTSQTSHLNLLLGFMKQWKARLGCGLESGPMALEQNLSDLQLQAAVEVAG
DLEVDCYRAPCSESQEELALQHFMKEKLLAELEGKLRVFENIVAVLNKEVEASHLALATSIHQSQLDRERILSLEQRVV
ELQQTLAQKDQALGKLEQ |
| Specificity: | TRAF1 - TNF receptor-associated factor 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody Reactive against Recombinant Protein with GST tag on ELISA and Western Blot. GST tag alone is used as a negative control. |
| Background: | The protein encoded by this gene is a member of the TNF receptor (TNFR) associated factor (TRAF) protein family. TRAF proteins associate with, and mediate the signal transduction from various receptors of the TNFR superfamily. This protein and TRAF2 form a heterodimeric complex, which is required for TNF-alpha-mediated activation of MAPK8/JNK and NF-kappaB. The protein complex formed by this protein and TRAF2 also interacts with inhibitor-of-apoptosis proteins (IAPs), and thus mediates the anti-apoptotic signals from TNF receptors. The expression of this protein can be induced by Epstein-Barr virus (EBV). EBV infection membrane protein 1 (LMP1) is found to interact with this and other TRAF proteins; this interaction is thought to link LMP1-mediated B lymphocyte transformation to the signal transduction from TNFR family receptors. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TRAF1 antibody, anti-TNF receptor-associated factor 1antibody, anti-EBI6 antibody, anti-MGC:10353antibody, anti-Epstein-Bar virus-induced protein 6 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |