| request information: |
|
| Catalog Code: | H00007182-M01 |
| Product Name: | NR2C2 Antibody |
| Product Description: | Mouse Monoclonal anti-NR2C2 (2A5) |
| Clone: | 2A5 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7182 |
| Gene Symbol: | NR2C2 |
| Omim ID: | 601426, |
| Immunogen: | NR2C2 (NP_003289, 43 a.a. ~ 153 a.a) partial recombinant protein with GST tag. |
| Epitope: | KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVI LASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTD VQRPQVVEYCVVCGDKASGRHYGAVS* |
| Specificity: | NR2C2 - nuclear receptor subfamily 2, group C, member 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against transfected lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Localization: | Nuclear |
| Background: | TR4 (TAK1, NR2C2) is an orphan nuclear receptor. TR4 was originally cloned from lymphoblastoma Raji cells or mouse brain cDNA library. No ligand has been reported. Northern blot shows TR4 is transcribed as a 9kb mRNA in many tissues and as a 2.8kb mRNA in testis, mainly in spermatocytes. TR4 has two isoforms called TR4alpha1 and TR4 alpha2,which differ in 19 amino acids coded by two separate exons. Both products translated from the 9kb transcript are ubiquitously expressed. Since TR4 binds to the same elements for the RAR-RXR or TR-RXR heterodimers, TR4 may have an inhibitory effect for retinoic-acid mediated transactivation. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-NR2C2 antibody, anti-TAK1 antibody, anti-TR2R1 antibody, anti-TR4 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |