| CatalogCode: | H00007182-A01 |
| ProductName: | NR2C2 Antibody |
| Product Description: | Mouse Polyclonal anti-NR2C2 |
| Clonality: | Polyclonal |
| Immunogen: | NR2C2 (NP_003289, 43 a.a. ~ 153 a.a) partial recombinant protein with GST tag. |
| Epitope: | KIVTDQQTGQKIQIVTAVDASGSPKQQFILTSPDGAGTGKVILASPETSSAKQLIFTTSDNLVPGRIQIVTDSASVERLLGKTDVQRPQVVEYCVVCGDKASGRHYGAVS* ... |
| Specificity: | NR2C2 - nuclear receptor subfamily 2, group C, member 2 |
| CrossReactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein.
Abnova's recommended working dilutions for western analysis are as follows:
1:500 dilution for ascites
1:1000 for purified Ig
1:500-1:1000 for polysera |
| Background: | Members of the nuclear hormone receptor family, such as NR2C2, act as ligand-activated transcription factors. The proteins have an N-terminal transactivation domain, a central DNA-binding domain with 2 zinc fingers, and a ligand-binding domain at the C terminus. The activated receptor/ligand complex is translocated to the nucleus where it binds to hormone response elements of target genes (Yoshikawa et al., 1996 [PubMed 8661150]).[supplied by OMIM] |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host_Name: | Mouse |
| ListPrice: | 225 |
| AppSummary: | ELISA, WB |
| SpeciesSummary: | Hu |
| ALTnames: | anti-TAK1 antibody, anti-TR2R1 antibody, anti-TR4 antibody, anti-hTAK1 antibody |
| ProteinTarget: | NR2C2 - nuclear receptor subfamily 2, group C, member 2 |
| PackageSize: | 0.05 ml |
| NotesMain: | This antibody is available only in North America and is supplied by Abnova If in stock in Taiwan. delivery is 10-14 days. If not in stock. lead times can be extended. We will inform you of any extended delays within 48 hours. The immunizing protein is also available for this product. Unit cost for the protein is $ 250 (2 ug). $ 305 (10 ug). and $ 445 (25 ug). |
| Gene_Id: | 7182 |
| Gene_Symbol: | NR2C2 |
| Omim_ID: | 601426 H00007182-M01 |
order or
more information: | company product webpage |
| request information: |
|