| request information: |
|
| Catalog Code: | H00007178-M03 |
| Product Name: | tumor protein, translationally-controlled 1 Antibody |
| Product Description: | Mouse Monoclonal anti-tumor protein, translationally-controlled 1 (2C4) |
| Clone: | 2C4 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7178 |
| Gene Symbol: | TPT1 |
| Omim ID: | 600763, |
| Immunogen: | TPT1 (AAH22436, 35 a.a. ~ 139 a.a) partial recombinant protein with GST tag. |
| Epitope: | GVDIVMNHHLQETSFTKEAYKKYIKDYMKSIKGKLEEQRPERVKPFMTGAAEQIKHILANFKNYQFFIGENMNPDGMVA
LLDYREDGVTPYMIFFKDGLEMEKC* |
| Specificity: | tumor protein, translationally-controlled 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2a Kappa |
| Host Name: | Mouse |
| Buffer: | 1X PBS pH 7.2 |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-FLJ27337 antibody, anti-HRF antibody, anti-TCTP antibody, anti-p02 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |