| request information: |
|
| Catalog Code: | H00007175-M01 |
| Product Name: | TPR Antibody |
| Product Description: | Mouse Monoclonal anti-TPR (1A8) |
| Clone: | 1A8 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7175 |
| Gene Symbol: | TPR |
| Omim ID: | 189940, |
| Immunogen: | TPR (NP_003283, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQSLR
LELEKLNNQLKALTEKNKE* |
| Specificity: | TPR - translocated promoter region (to activated MET oncogene) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for Western Blot. Has also been used for immunohistochemistry (paraffin) and ELISA. |
| Background: | This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TPR antibody, anti-Translocated Promoter Regi |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
| Product References: | Chan EY, Katze MG et al.. Quantitative Analysis of HIV-1 Infected CD4+ Cell Proteome: Dysregulated Cell Cycle Progression and Nuclear Transport Coincide with Robust Virus Production. J Virol. 2007 Jul;81(14):7571-83. Epub 2007 May 9.Click here to read |
order or
more information: | company product webpage |