| request information: |
|
| Catalog Code: | H00007175-A01 |
| Product Name: | TPR Antibody |
| Product Description: | Mouse Polyclonal anti-TPR |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7175 |
| Gene Symbol: | TPR |
| Omim ID: | 189940, |
| Immunogen: | TPR (NP_003283, 1 a.a. ~ 99 a.a) partial recombinant protein with GST tag. |
| Epitope: | MAAVLQQVLERTELNKLPKSVQNKLEKFLADQQSEIDGLKGRHEKFKVESEQQYFEIEKRLSHSQERLVNETRECQSLR
LELEKLNNQLKALTEKNKE* |
| Specificity: | TPR - translocated promoter region (to activated MET oncogene) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a large coiled-coil protein that forms intranuclear filaments attached to the inner surface of nuclear pore complexes (NPCs). The protein directly interacts with several components of the NPC. It is required for the nuclear export of mRNAs and some proteins. Oncogenic fusions of the 5' end of this gene with several different kinase genes occur in some neoplasias. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TPR antibody, anti-Translocated Promoter Region antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |