| request information: |
|
| Catalog Code: | H00007166-A01 |
| Product Name: | TPH1 Antibody |
| Product Description: | Mouse Polyclonal anti-TPH1 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7166 |
| Gene Symbol: | TPH1 |
| Omim ID: | 191060 |
| Immunogen: | TPH1 (NP_004170, 1 a.a. ~ 118 a.a) partial recombinant protein with GST tag. |
| Epitope: | MIEDNKENKDHSLERGRASLIFSLKNEVGGLIKALKIFQEKHVNLLHIESRKSKRRNSEFEIFVDCDINREQLNDIFHL
LKSHTNVLSVNLPDNFTLKEDGMETVPWFPKKISDLDH* |
| Specificity: | TPH1 - tryptophan hydroxylase 1 (tryptophan 5-monooxygenase) |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | This gene encodes a member of the pterin-dependent aromatic acid hydroxylase family. The encoded protein catalyzes the first and rate limiting step in the biosynthesis of serotonin, an important hormone and neurotransmitter. The human genome contains two related tryptophan hydroxylases, one on chromosome 11p15-p14 and one on chromosome 12q21. This gene is expressed predominantly in the gut, pineal gland, spleen, and thymus. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-TPH antibody, anti-TPRH antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |