| request information: |
|
| Catalog Code: | H00007162-M03 |
| Product Name: | TPBG Antibody |
| Product Description: | Mouse Monoclonal anti-TPBG (3D6) |
| Clone: | 3D6 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7162 |
| Gene Symbol: | TPBG |
| Omim ID: | 190920, |
| Immunogen: | TPBG (NP_006661, 219 a.a. ~ 329 a.a) partial recombinant protein with GST tag. |
| Epitope: | SNHFLYLPRDVLAQLPSLRHLDLSNNSLVSLTYVSFRNLTHLESLHLEDNALKVLHNGTLAELQGLPHIRVFLDNNPWV
CDCHMADMVTWLKETEVVQGKDRLTCAYPEK* |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG2b Kappa |
| Host Name: | Mouse |
| Buffer: | In 1x PBS, pH 7.2 |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-5T4 antibody, anti-5T4-AG antibody, anti-M6P1 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |