| request information: |
|
| Catalog Code: | H00007158-M01 |
| Product Name: | TP53BP1 Antibody |
| Product Description: | Mouse Monoclonal anti-TP53BP1 (1B9) |
| Clone: | 1B9 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7158 |
| Gene Symbol: | TP53BP1 |
| Omim ID: | 605230 |
| Immunogen: | TP53BP1 (NP_005648, 1766 a.a. ~ 1875 a.a) partial recombinant protein with GST tag. |
| Epitope: | LEIPPFNKQYTESQLRAGAGYILEDFNEAQCNTAYQCLLIADQHCRTRKYFLCLASGIPCVSHVWVHDSCHANQLQNYR
NYLLPAGYSLEEQRILDWQPRENPFQNLKV* |
| Specificity: | TP53BP1 - tumor protein p53 binding protein, 1 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recombinant protein on ELISA. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA |
| Species Summary: | Hu |
| Alternate Names: | anti-53BP1 antibody, anti-p202 antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |