| request information: |
|
| Catalog Code: | H00007153-M01 |
| Product Name: | TOP2A Antibody |
| Product Description: | Mouse Monoclonal anti-TOP2A (1E2) |
| Clone: | 1E2 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7153 |
| Gene Symbol: | TOP2A |
| Omim ID: | 126430 |
| Immunogen: | TOP2A (NP_001058, 1435 a.a. ~ 1532 a.a) partial recombinant protein with GST tag. |
| Epitope: | RAAPKGTKRDPALNSGVSQKPDPAKTKNRRKRKPSTSDDSDS NFEKIVSKAVTSKKSKGESDDFHMDFDSAVAPRAKSVRAKKP IKYLEESDEDDLF* |
| Specificity: | TOP2A - topoisomerase (DNA) II alpha 170kDa |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against recominant protein and cell lysate for Western Blot. Has also been used for immunofluoresence, immunohistochemistry (paraffin), and ELISA. |
| Localization: | Cytoplasmic and Nuclear; nucleoplasm. Note: Generally located in the nucleoplasm. |
| Background: | This gene encodes a DNA topoisomerase, an enzyme that controls and alters the topologic states of DNA during transcription. This nuclear enzyme is involved in processes such as chromosome condensation, chromatid separation, and the relief of torsional stress that occurs during DNA transcription and replication. It catalyzes the transient breaking and rejoining of two strands of duplex DNA which allows the strands to pass through one another, thus altering the topology of DNA. Two forms of this enzyme exist as likely products of a gene duplication event. The gene encoding this form, alpha, is localized to chromsome 17 and the beta gene is localized to chromosome 3. The gene encoding this enzyme functions as the target for several anticancer agents and a variety of mutations in this gene have been associated with the development of drug resistance. Reduced activity of this enzyme may also play a role in ataxia-telangiectasia. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 Kappa |
| Host Name: | Mouse |
| Buffer: | Phosphate buffered saline, pH 7.2 |
| Application Summary: | ELISA, immunofluorescence, Immunohistochemistry-Paraffin, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-Topoisomerase II alpha antibody, anti-DNA topoisomerase 2 alpha antibody, anti-DNA topoisomerase II 170 kD antibody, anti-DNA topoisomerase II alpha isozyme antibody, anti-DNA Topoisomerase2 antibody, anti-TOP 2 antibody, anti-TOP 2A antibody, anti-TOP2 antibody, anti-TOP2A antibody, anti-TopII alpha antibody, anti-Topo II alpha antibody, anti-Topoisomerase DNA II alpha 170kDa antibody, anti-Topoisomerase II alpha 170 kDa antibody, anti-TP2A antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |