| request information: |
|
| Catalog Code: | H00007139-M01 |
| Product Name: | TNNT2 Antibody |
| Product Description: | Mouse Monoclonal anti-TNNT2 (3H4-F7) |
| Clone: | 3H4-F7 |
| Clonality: | Monoclonal |
| ListPrice: | 295 |
| Gene ID: | 7139 |
| Gene Symbol: | TNNT2 |
| Omim ID: | 115,195,191,045,601,000 |
| Immunogen: | TNNT2 (AAH02653, 1 a.a. ~ 286 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKI
PDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERAR
REEEENRRKAEDEARKKKALSNMMHFGGYIQKTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSI
YNLEAEKFDLQEKFKQQK |
| Specificity: | TNNT2 - troponin T2, cardiac |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.1 mg IgG purified Mouse ascites. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | IgG purified |
| Isotype: | IgG1 kappa |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CMD1D antibody, anti-CMH2 antibody, anti-MGC3889 antibody, anti-TnTC antibody, anti-cTnT antibody, anti-troponin T antibody |
| Package Size: | 0.1 mg |
| Preservative: | No preservative |
order or
more information: | company product webpage |