| request information: |
|
| Catalog Code: | H00007139-A01 |
| Product Name: | TNNT2 Antibody |
| Product Description: | Mouse Polyclonal anti-TNNT2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7139 |
| Gene Symbol: | TNNT2 |
| Omim ID: | 115195 191045 601494 |
| Immunogen: | TNNT2 (AAH02653, 1 a.a. ~ 286 a.a) full length recombinant protein with GST tag. |
| Epitope: | MSDIEEVVEEYEEEEQEEAAVEEQEEAAEEDAEAEAETEETRAEEDEEEEEAKEAEDGPMEESKPKPRSFMPNLVPPKI
PDGERVDFDDIHRKRMEKDLNELQALIEAHFENRKKEEEELVSLKDRIERRRAERAEQQRIRNEREKERQNRLAEERAR
REEEENRRKAEDEARKKKALSNMMHFGGYIQKTERKSGKRQTEREKKKKILAERRKVLAIDHLNEDQLREKAKELWQSI
YNLEAEKFDLQEKFKQQK |
| Specificity: | TNNT2 - troponin T2, cardiac |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polysera |
| Background: | The protein encoded by this gene is the tropomyosin-binding subunit of the troponin complex, which is located on the thin filament of striated muscles and regulates muscle contraction in response to alterations in intracellular calcium ion concentration. Mutations in this gene have been associated with familial hypertrophic cardiomyopathy as well as with dilated cardiomyopathy. Transcripts for this gene undergo alternative splicing that results in many tissue-specific isoforms, however, the full-length nature of some of these variants has not yet been determined. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-CMD1D antibody, anti-CMH2 antibody, anti-MGC3889 antibody, anti-TnTC antibody, anti-cTnT antibody, anti-troponin T antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |