| request information: |
|
| Catalog Code: | H00007127-A01 |
| Product Name: | TNFAIP2 Antibody |
| Product Description: | Mouse Polyclonal anti-TNFAIP2 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7127 |
| Gene Symbol: | TNFAIP2 |
| Omim ID: | 603300 |
| Immunogen: | TNFAIP2 (NP_006282, 552 a.a. ~ 651 a.a) partial recombinant protein with GST tag. |
| Epitope: | YILANADTIQHFCTQHGSPATWLQPALPTLAEIIRLQDPSAIKIEVATYATCYPDFSKGHLSAILAIKGNLSNSEVKRI
RSILDVSMGAQEPSRPLFSL* |
| Specificity: | TNFAIP2 - tumor necrosis factor, alpha-induced protein 2 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. No preservative. |
| Uses: | Antibody reactive against cell lysate and recombinant protein for western blot. It has also been used for ELISA. |
| Background: | This gene was identified as a gene whose expression can be induced by the tumor necrosis factor alpha (TNF) in umbilical vein endothelial cells. The expression of this gene was shown to be induced by retinoic acid in a cell line expressing a oncogenic version of the retinoic acid receptor alpha fusion protein, which suggested that this gene may be a retinoic acid target gene in acute promyelocytic leukemia. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Purity: | Whole antisera |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-B94 antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |