| request information: |
|
| Catalog Code: | H00007102-A01 |
| Product Name: | tetraspanin 7 Antibody |
| Product Description: | Mouse Polyclonal anti-tetraspanin 7 |
| Clonality: | Polyclonal |
| ListPrice: | 225 |
| Gene ID: | 7102 |
| Gene Symbol: | TSPAN7 |
| Omim ID: | 300096, 300218, |
| Immunogen: | TSPAN7 (NP_004606, 113 a.a. ~ 213 a.a) partial recombinant protein with GST tag. |
| Epitope: | RHEIKDTFLRTYTDAMQTYNGNDERSRAVDHVQRSLSCCGVQNYTNWSTSPYFLEHGIPPSCCMNETDCNPQDLHNLTV
AATKVNQKGCYDLVTSFMETN* |
| Specificity: | tetraspanin 7 |
| Cross Reactivity: | Human. Other species not tested. |
| Packaging: | 0.05 ml of mouse antisera with 50% glycerol. |
| Uses: | The quality control of this antibody is limited to Western blot on the immunizing protein. Abnovas recommended working dilutions for western analysis are as follows:1:500 dilution for ascites1:1000 for purified Ig1:500-1:1000 for polyseraOther applications have not been tested. |
| Background: | The protein encoded by this gene is a member of the transmembrane 4 superfamily, also known as the tetraspanin family. Most of these members are cell-surface proteins that are characterized by the presence of four hydrophobic domains. The proteins mediate signal transduction events that play a role in the regulation of cell development, activation, growth and motility. This encoded protein is a cell surface glycoprotein and may have a role in the control of neurite outgrowth. It is known to complex with integrins. This gene is associated with X-linked mental retardation and neuropsychiatric diseases such as Huntington's chorea, fragile X syndrome and myotonic dystrophy. |
| Storage: | Aliquot and store at -20C or -80C. Avoid freeze-thaw cycles. |
| Host Name: | Mouse |
| Application Summary: | ELISA, Western Blot |
| Species Summary: | Hu |
| Alternate Names: | anti-A15 antibody, anti-CCG-B7 antibody, anti-CD231 antibody, anti-DXS1692E antibody, anti-MXS1 antibody, anti-TALLA-1 antibody, anti-TM4SF2 antibody, anti-TM4SF2b antibody |
| Package Size: | 0.05 ml |
| Preservative: | No preservative |
order or
more information: | company product webpage |